SCOPe 2.01: Domain d1ug9a3: 1ug9 A:776-1020

Lineage for d1ug9a3 (1ug9 A:776-1020)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.9: CBD9-like [49344] (3 families)
   has additional strand at N-terminus; the active site in a similar topological location as the Cu,Zn SOD site

5. Family b.1.9.3: Glucodextranase, domain C [101533] (1 protein)

6. Protein Glucodextranase, domain C [101534] (1 species)

7. Species Arthrobacter globiformis [TaxId:1665] [101535] (2 PDB entries)

8. Domain d1ug9a3: 1ug9 A:776-1020 [99363]
   Other proteins in same PDB: d1ug9a1, d1ug9a2, d1ug9a4
   complexed with ca, gol

Details for d1ug9a3

PDB Entry: 1ug9, 2.5 Å

PDB Description: Crystal Structure of Glucodextranase from Arthrobacter globiformis I42

PDB Compounds: (A:) glucodextranase

SCOPe Domain Sequences for d1ug9a3:

Sequence; same for both SEQRES and ATOM records:

>d1ug9a3 b.1.9.3 (A:776-1020) Glucodextranase, domain C {Arthrobacter globiformis [TaxId: 1665]}
rigalsdpagddngpgtyryptnsayvpgafdltgvdvydagddyafvatiagevtnpwg
gqaishqrvniylgkgeggatpglpgtninlehawdsvivtdgrfdgagvyapdgtrtsa
vsllavpearqivtrvpkaalggldpatarmsvamfgnaesgegignvrpvydgayweag
dpawikewrfgggagvfdgtipsrdtdtddpnaldvlvgegqtqaavldwragspvvvpm
lglqp

Timeline for d1ug9a3:

• d1ug9a3 first appeared in SCOP 1.67
  
• d1ug9a3 appears in SCOP 1.75
  
• d1ug9a3 appears in SCOPe 2.02
  
• d1ug9a3 appears in the current release, SCOPe 2.08