![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.9: CBD9-like [49344] (3 families) ![]() has additional strand at N-terminus; the active site in a similar topological location as the Cu,Zn SOD site |
![]() | Family b.1.9.3: Glucodextranase, domain C [101533] (1 protein) |
![]() | Protein Glucodextranase, domain C [101534] (1 species) |
![]() | Species Arthrobacter globiformis [TaxId:1665] [101535] (2 PDB entries) |
![]() | Domain d1ug9a3: 1ug9 A:776-1020 [99363] Other proteins in same PDB: d1ug9a1, d1ug9a2, d1ug9a4 complexed with ca, gol |
PDB Entry: 1ug9 (more details), 2.5 Å
SCOP Domain Sequences for d1ug9a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ug9a3 b.1.9.3 (A:776-1020) Glucodextranase, domain C {Arthrobacter globiformis [TaxId: 1665]} rigalsdpagddngpgtyryptnsayvpgafdltgvdvydagddyafvatiagevtnpwg gqaishqrvniylgkgeggatpglpgtninlehawdsvivtdgrfdgagvyapdgtrtsa vsllavpearqivtrvpkaalggldpatarmsvamfgnaesgegignvrpvydgayweag dpawikewrfgggagvfdgtipsrdtdtddpnaldvlvgegqtqaavldwragspvvvpm lglqp
Timeline for d1ug9a3: