SCOP 1.67: Domain d1ug9a2: 1ug9 A:687-775

Lineage for d1ug9a2 (1ug9 A:687-775)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (16 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Glucodextranase, domain B [101525] (1 species)

7. Species Arthrobacter globiformis [TaxId:1665] [101526] (2 PDB entries)

8. Domain d1ug9a2: 1ug9 A:687-775 [99362]
   Other proteins in same PDB: d1ug9a1, d1ug9a3, d1ug9a4
   complexed with ca, gol

Details for d1ug9a2

PDB Entry: 1ug9, 2.5 Å

PDB Description: Crystal Structure of Glucodextranase from Arthrobacter globiformis I42

SCOP Domain Sequences for d1ug9a2:

Sequence; same for both SEQRES and ATOM records:

>d1ug9a2 b.1.18.2 (A:687-775) Glucodextranase, domain B {Arthrobacter globiformis}
tplsspelsvtapealstadsatavvrgttnaakvyvsvngtateapvtdgtfsldvalt
gaknkvtvaavaadggtavedrtvlyygs

Timeline for d1ug9a2:

• d1ug9a2 is new in SCOP 1.67
  
• d1ug9a2 appears in SCOP 1.69
  
• d1ug9a2 appears in the current release, SCOPe 2.08