Lineage for d1ug9a1 (1ug9 A:274-686)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004216Family a.102.1.5: Bacterial glucoamylase C-terminal domain-like [81850] (2 protein domains)
    overall domain organization is similar to Lactobacillus maltose phosphorylase
  6. 2004223Protein Glucodextranase, domain A [101365] (1 species)
  7. 2004224Species Arthrobacter globiformis [TaxId:1665] [101366] (2 PDB entries)
  8. 2004226Domain d1ug9a1: 1ug9 A:274-686 [99361]
    Other proteins in same PDB: d1ug9a2, d1ug9a3, d1ug9a4
    complexed with ca, gol

Details for d1ug9a1

PDB Entry: 1ug9 (more details), 2.5 Å

PDB Description: Crystal Structure of Glucodextranase from Arthrobacter globiformis I42
PDB Compounds: (A:) glucodextranase

SCOPe Domain Sequences for d1ug9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug9a1 a.102.1.5 (A:274-686) Glucodextranase, domain A {Arthrobacter globiformis [TaxId: 1665]}
patsltgalrtqydvslmtvkshedktfpgafiasltipwgqaasaethregyhavward
myqsvtallaagdeeaaargvewlftyqqqpdghfpqtsrvdgtigqngiqldetafpil
lanqigrtdagfyrnelkpaadylvaagpktpqerweetggyststlasqiaalaaaadi
agkngdagsaavyratadewqrstekwmfttngpvgdgkyylrisatgnpndgatrdwgn
gagvhpenavldggflefvrlgvkapadpyvadslaetdasisqetpggrmwhrytydgy
gekadgspwdgtgigrlwpllsgergeyalangqdalpyletmhsaanagymipeqvwdr
deptsyghelgrstgsasplswamaqyvrlaagvkagapvetpqnvaaryaag

SCOPe Domain Coordinates for d1ug9a1:

Click to download the PDB-style file with coordinates for d1ug9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ug9a1: