Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Hypothetical protein Baa76854.1 (KIAA1010) [101671] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101672] (2 PDB entries) |
Domain d1ug1a1: 1ug1 A:8-85 [99360] Other proteins in same PDB: d1ug1a2, d1ug1a3 structural genomics; second last SH3 domain |
PDB Entry: 1ug1 (more details)
SCOPe Domain Sequences for d1ug1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ug1a1 b.34.2.1 (A:8-85) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} asllaryppeklfqaernfnaaqdldvsllegdlvgvikkkdpmgsqnrwlidngvtkgf vyssflkpynprrshsda
Timeline for d1ug1a1: