Lineage for d1ug1a1 (1ug1 A:8-85)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783122Protein Hypothetical protein Baa76854.1 (KIAA1010) [101671] (1 species)
  7. 2783123Species Human (Homo sapiens) [TaxId:9606] [101672] (2 PDB entries)
  8. 2783125Domain d1ug1a1: 1ug1 A:8-85 [99360]
    Other proteins in same PDB: d1ug1a2, d1ug1a3
    structural genomics; second last SH3 domain

Details for d1ug1a1

PDB Entry: 1ug1 (more details)

PDB Description: sh3 domain of hypothetical protein baa76854.1
PDB Compounds: (A:) KIAA1010 protein

SCOPe Domain Sequences for d1ug1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug1a1 b.34.2.1 (A:8-85) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]}
asllaryppeklfqaernfnaaqdldvsllegdlvgvikkkdpmgsqnrwlidngvtkgf
vyssflkpynprrshsda

SCOPe Domain Coordinates for d1ug1a1:

Click to download the PDB-style file with coordinates for d1ug1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ug1a1: