Lineage for d1ufwa1 (1ufw A:8-89)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952304Protein Synaptojanin 2 [102985] (1 species)
  7. 2952305Species Human (Homo sapiens) [TaxId:9606] [102986] (1 PDB entry)
  8. 2952306Domain d1ufwa1: 1ufw A:8-89 [99358]
    Other proteins in same PDB: d1ufwa2, d1ufwa3
    structural genomics

Details for d1ufwa1

PDB Entry: 1ufw (more details)

PDB Description: solution structure of rnp domain in synaptojanin 2
PDB Compounds: (A:) Synaptojanin 2

SCOPe Domain Sequences for d1ufwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufwa1 d.58.7.1 (A:8-89) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]}
ssfqgpldatvvvnlqsptleeknefpedlrtelmqtlgsygtivlvrinqgqmlvtfad
shsalsvldvdgmkvkgravki

SCOPe Domain Coordinates for d1ufwa1:

Click to download the PDB-style file with coordinates for d1ufwa1.
(The format of our PDB-style files is described here.)

Timeline for d1ufwa1: