Lineage for d1ufrd_ (1ufr D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398986Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 398987Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 398988Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (10 proteins)
  6. 399116Protein Uracil PRTase [53293] (5 species)
  7. 399129Species Thermus thermophilus [TaxId:274] [102537] (1 PDB entry)
    TT1027; Pyr RNA-binding attenuation protein PyrR
  8. 399133Domain d1ufrd_: 1ufr D: [99357]
    structural genomics
    complexed with cl

Details for d1ufrd_

PDB Entry: 1ufr (more details), 2.6 Å

PDB Description: Crystal Structure of TT1027 from Thermus thermophilus HB8

SCOP Domain Sequences for d1ufrd_:

Sequence, based on SEQRES records: (download)

>d1ufrd_ c.61.1.1 (D:) Uracil PRTase {Thermus thermophilus}
rfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegke
vpvgvlditlyrddlteigyrpqvretripfdltgkaivlvddvlytgrtaraaldalid
lgrprriylavlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer

Sequence, based on observed residues (ATOM records): (download)

>d1ufrd_ c.61.1.1 (D:) Uracil PRTase {Thermus thermophilus}
rfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegke
vpvgvlditlpqvretripfdltgkaivlvddvlytgrtaraaldalidlgrprriylav
lvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer

SCOP Domain Coordinates for d1ufrd_:

Click to download the PDB-style file with coordinates for d1ufrd_.
(The format of our PDB-style files is described here.)

Timeline for d1ufrd_: