Lineage for d1ufrd_ (1ufr D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891604Protein Pyrimidine operon regulator PyrR [109612] (4 species)
    bifunctional protein; contains the uracil PRTase and Pyr RNA-binding activities
  7. 2891623Species Thermus thermophilus [TaxId:274] [102537] (1 PDB entry)
    TT1027
  8. 2891627Domain d1ufrd_: 1ufr D: [99357]
    structural genomics
    complexed with cl

Details for d1ufrd_

PDB Entry: 1ufr (more details), 2.6 Å

PDB Description: Crystal Structure of TT1027 from Thermus thermophilus HB8
PDB Compounds: (D:) pyr mRNA-binding attenuation protein

SCOPe Domain Sequences for d1ufrd_:

Sequence, based on SEQRES records: (download)

>d1ufrd_ c.61.1.1 (D:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]}
rfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegke
vpvgvlditlyrddlteigyrpqvretripfdltgkaivlvddvlytgrtaraaldalid
lgrprriylavlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer

Sequence, based on observed residues (ATOM records): (download)

>d1ufrd_ c.61.1.1 (D:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]}
rfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegke
vpvgvlditlpqvretripfdltgkaivlvddvlytgrtaraaldalidlgrprriylav
lvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer

SCOPe Domain Coordinates for d1ufrd_:

Click to download the PDB-style file with coordinates for d1ufrd_.
(The format of our PDB-style files is described here.)

Timeline for d1ufrd_: