SCOPe 2.06: Domain d1ufrc_: 1ufr C:

Lineage for d1ufrc_ (1ufr C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Pyrimidine operon regulator PyrR [109612] (4 species)
   bifunctional protein; contains the uracil PRTase and Pyr RNA-binding activities

7. Species Thermus thermophilus [TaxId:274] [102537] (1 PDB entry)
   TT1027

8. Domain d1ufrc_: 1ufr C: [99356]
   structural genomics
   complexed with cl

Details for d1ufrc_

PDB Entry: 1ufr, 2.6 Å

PDB Description: Crystal Structure of TT1027 from Thermus thermophilus HB8

PDB Compounds: (C:) pyr mRNA-binding attenuation protein

SCOPe Domain Sequences for d1ufrc_:

Sequence, based on SEQRES records:

>d1ufrc_ c.61.1.1 (C:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]}
rfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegke
vpvgvlditlyrddlteigyrpqvretripfdltgkaivlvddvlytgrtaraaldalid
lgrprriylavlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer

Sequence, based on observed residues (ATOM records):

>d1ufrc_ c.61.1.1 (C:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]}
rfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegke
vpvgvlditlpqvretripfdltgkaivlvddvlytgrtaraaldalidlgrprriylav
lvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer

Timeline for d1ufrc_:

• d1ufrc_ first appeared in SCOP 1.67
  
• d1ufrc_ appears in SCOPe 2.05
  
• d1ufrc_ appears in SCOPe 2.07
  
• d1ufrc_ appears in the current release, SCOPe 2.08