Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Pyrimidine operon regulator PyrR [109612] (4 species) bifunctional protein; contains the uracil PRTase and Pyr RNA-binding activities |
Species Thermus thermophilus [TaxId:274] [102537] (1 PDB entry) TT1027 |
Domain d1ufrc_: 1ufr C: [99356] structural genomics complexed with cl |
PDB Entry: 1ufr (more details), 2.6 Å
SCOPe Domain Sequences for d1ufrc_:
Sequence, based on SEQRES records: (download)
>d1ufrc_ c.61.1.1 (C:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]} rfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegke vpvgvlditlyrddlteigyrpqvretripfdltgkaivlvddvlytgrtaraaldalid lgrprriylavlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer
>d1ufrc_ c.61.1.1 (C:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]} rfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegke vpvgvlditlpqvretripfdltgkaivlvddvlytgrtaraaldalidlgrprriylav lvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer
Timeline for d1ufrc_: