Lineage for d1ufrb_ (1ufr B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489867Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 489868Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 489869Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (11 proteins)
  6. 490010Protein Pyrimidine operon regulator PyrR [109612] (3 species)
    bifunctional protein; contains the uracil PRTase and Pyr RNA-binding activities
  7. 490020Species Thermus thermophilus [TaxId:274] [102537] (1 PDB entry)
    TT1027
  8. 490022Domain d1ufrb_: 1ufr B: [99355]

Details for d1ufrb_

PDB Entry: 1ufr (more details), 2.6 Å

PDB Description: Crystal Structure of TT1027 from Thermus thermophilus HB8

SCOP Domain Sequences for d1ufrb_:

Sequence, based on SEQRES records: (download)

>d1ufrb_ c.61.1.1 (B:) Pyrimidine operon regulator PyrR {Thermus thermophilus}
mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
evpvgvlditlyrddlteigyrpqvretripfdltgkaivlvddvlytgrtaraaldali
dlgrprriylavlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer

Sequence, based on observed residues (ATOM records): (download)

>d1ufrb_ c.61.1.1 (B:) Pyrimidine operon regulator PyrR {Thermus thermophilus}
mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
evpvgvlditlpqvretripfdltgkaivlvddvlytgrtaraaldalidlgrprriyla
vlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer

SCOP Domain Coordinates for d1ufrb_:

Click to download the PDB-style file with coordinates for d1ufrb_.
(The format of our PDB-style files is described here.)

Timeline for d1ufrb_: