Lineage for d1ufra_ (1ufr A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863464Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1863465Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1863466Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 1863693Protein Pyrimidine operon regulator PyrR [109612] (4 species)
    bifunctional protein; contains the uracil PRTase and Pyr RNA-binding activities
  7. 1863712Species Thermus thermophilus [TaxId:274] [102537] (1 PDB entry)
    TT1027
  8. 1863713Domain d1ufra_: 1ufr A: [99354]
    structural genomics
    complexed with cl

Details for d1ufra_

PDB Entry: 1ufr (more details), 2.6 Å

PDB Description: Crystal Structure of TT1027 from Thermus thermophilus HB8
PDB Compounds: (A:) pyr mRNA-binding attenuation protein

SCOPe Domain Sequences for d1ufra_:

Sequence, based on SEQRES records: (download)

>d1ufra_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]}
mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
evpvgvlditlyrddlteigyrpqvretripfdltgkaivlvddvlytgrtaraaldali
dlgrprriylavlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer

Sequence, based on observed residues (ATOM records): (download)

>d1ufra_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]}
mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegk
evpvgvlditlpqvretripfdltgkaivlvddvlytgrtaraaldalidlgrprriyla
vlvdrghrelpiradfvgknvptsrsevvkvkveevdgedrvelwer

SCOPe Domain Coordinates for d1ufra_:

Click to download the PDB-style file with coordinates for d1ufra_.
(The format of our PDB-style files is described here.)

Timeline for d1ufra_: