Lineage for d1ufqd_ (1ufq D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110026Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 protein domains)
  6. 2110050Protein Uridine-cytidine kinase 2 [102360] (1 species)
  7. 2110051Species Human (Homo sapiens) [TaxId:9606] [102361] (6 PDB entries)
  8. 2110065Domain d1ufqd_: 1ufq D: [99353]

Details for d1ufqd_

PDB Entry: 1ufq (more details), 2.5 Å

PDB Description: Crystal structure of ligand-free human uridine-cytidine kinase 2
PDB Compounds: (D:) Uridine-cytidine kinase 2

SCOPe Domain Sequences for d1ufqd_:

Sequence, based on SEQRES records: (download)

>d1ufqd_ c.37.1.6 (D:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
ptkkyadviiprgadnlvainlivqhiqdiln

Sequence, based on observed residues (ATOM records): (download)

>d1ufqd_ c.37.1.6 (D:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
afysqevrdlfqmklfvdtdadtrlsrrvlrdisgrdleqilsqyitfvkpafeefclpt
kkyadviiprgadnlvainlivqhiqdiln

SCOPe Domain Coordinates for d1ufqd_:

Click to download the PDB-style file with coordinates for d1ufqd_.
(The format of our PDB-style files is described here.)

Timeline for d1ufqd_: