Lineage for d1ufoe_ (1ufo E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901645Family c.69.1.27: Hypothetical protein TT1662 [102616] (1 protein)
    automatically mapped to Pfam PF12697
  6. 2901646Protein Hypothetical protein TT1662 [102617] (1 species)
  7. 2901647Species Thermus thermophilus [TaxId:274] [102618] (1 PDB entry)
  8. 2901652Domain d1ufoe_: 1ufo E: [99348]
    structural genomics

Details for d1ufoe_

PDB Entry: 1ufo (more details), 1.6 Å

PDB Description: Crystal Structure of TT1662 from Thermus thermophilus
PDB Compounds: (E:) hypothetical protein TT1662

SCOPe Domain Sequences for d1ufoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufoe_ c.69.1.27 (E:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]}
mrvrterltlaglsvlaripeapkalllalhglqgskehilallpgyaergflllafdap
rhgeregpppsskspryveevyrvalgfkeearrvaeeaerrfglplflaggslgafvah
lllaegfrprgvlafigsgfpmklpqgqvvedpgvlalyqappatrgeayggvpllhlhg
srdhivplarmektlealrphypegrlarfveegaghtltplmarvglaflehwlear

SCOPe Domain Coordinates for d1ufoe_:

Click to download the PDB-style file with coordinates for d1ufoe_.
(The format of our PDB-style files is described here.)

Timeline for d1ufoe_: