![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.27: Hypothetical protein TT1662 [102616] (1 protein) automatically mapped to Pfam PF12697 |
![]() | Protein Hypothetical protein TT1662 [102617] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102618] (1 PDB entry) |
![]() | Domain d1ufoc_: 1ufo C: [99346] structural genomics |
PDB Entry: 1ufo (more details), 1.6 Å
SCOPe Domain Sequences for d1ufoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ufoc_ c.69.1.27 (C:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} mrvrterltlaglsvlaripeapkalllalhglqgskehilallpgyaergflllafdap rhgeregpppsskspryveevyrvalgfkeearrvaeeaerrfglplflaggslgafvah lllaegfrprgvlafigsgfpmklpqgqvvedpgvlalyqappatrgeayggvpllhlhg srdhivplarmektlealrphypegrlarfveegaghtltplmarvglaflehwlear
Timeline for d1ufoc_: