SCOPe 2.07: Domain d1ufob_: 1ufo B:

Lineage for d1ufob_ (1ufo B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.27: Hypothetical protein TT1662 [102616] (1 protein)
   automatically mapped to Pfam PF12697

6. Protein Hypothetical protein TT1662 [102617] (1 species)

7. Species Thermus thermophilus [TaxId:274] [102618] (1 PDB entry)

8. Domain d1ufob_: 1ufo B: [99345]
   structural genomics

Details for d1ufob_

PDB Entry: 1ufo, 1.6 Å

PDB Description: Crystal Structure of TT1662 from Thermus thermophilus

PDB Compounds: (B:) hypothetical protein TT1662

SCOPe Domain Sequences for d1ufob_:

Sequence; same for both SEQRES and ATOM records:

>d1ufob_ c.69.1.27 (B:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]}
mrvrterltlaglsvlaripeapkalllalhglqgskehilallpgyaergflllafdap
rhgeregpppsskspryveevyrvalgfkeearrvaeeaerrfglplflaggslgafvah
lllaegfrprgvlafigsgfpmklpqgqvvedpgvlalyqappatrgeayggvpllhlhg
srdhivplarmektlealrphypegrlarfveegaghtltplmarvglaflehwlear

Timeline for d1ufob_:

• d1ufob_ first appeared in SCOP 1.67
  
• d1ufob_ appears in SCOPe 2.06
  
• d1ufob_ appears in the current release, SCOPe 2.08