Lineage for d1uflb_ (1ufl B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. Protein PII (product of glnB) [54915] (8 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. Species Thermus thermophilus [TaxId:274] [102972] (5 PDB entries)
    Uniprot P83820
  8. Domain d1uflb_: 1ufl B: [99342]
    structural genomics

Details for d1uflb_

PDB Entry: 1ufl (more details), 2.7 Å

PDB Description: Crystal Structure of TT1020 from Thermus thermophilus HB8
PDB Compounds: (B:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d1uflb_:

Sequence, based on SEQRES records: (download)

>d1uflb_ d.58.5.1 (B:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]}
mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavt

Sequence, based on observed residues (ATOM records): (download)

>d1uflb_ d.58.5.1 (B:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]}
mklivaivrpeklnevlkalfqaevrgltlsrvqghelhekvrleigvsepfvkptveai
lkaartgevgdgkifvlpvekvyrirtgeedeaavt

SCOPe Domain Coordinates for d1uflb_ are not available.

Timeline for d1uflb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ufla_, d1uflc_