![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
![]() | Superfamily a.30.4: Dimerisation domain of CENP-B [101160] (1 family) ![]() automatically mapped to Pfam PF09026 |
![]() | Family a.30.4.1: Dimerisation domain of CENP-B [101161] (1 protein) |
![]() | Protein Dimerisation domain of CENP-B [101162] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101163] (1 PDB entry) |
![]() | Domain d1ufid1: 1ufi D:5-48 [99339] Other proteins in same PDB: d1ufia2, d1ufic2, d1ufid2 |
PDB Entry: 1ufi (more details), 1.65 Å
SCOPe Domain Sequences for d1ufid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ufid1 a.30.4.1 (D:5-48) Dimerisation domain of CENP-B {Human (Homo sapiens) [TaxId: 9606]} pvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtr
Timeline for d1ufid1: