Lineage for d1ufic_ (1ufi C:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 354822Fold a.30: ROP-like [47379] (4 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 354862Superfamily a.30.4: Dimerisation domain of CENP-B [101160] (1 family) (S)
  5. 354863Family a.30.4.1: Dimerisation domain of CENP-B [101161] (1 protein)
  6. 354864Protein Dimerisation domain of CENP-B [101162] (1 species)
  7. 354865Species Human (Homo sapiens) [TaxId:9606] [101163] (1 PDB entry)
  8. 354868Domain d1ufic_: 1ufi C: [99338]

Details for d1ufic_

PDB Entry: 1ufi (more details), 1.65 Å

PDB Description: Crystal structure of the dimerization domain of human CENP-B

SCOP Domain Sequences for d1ufic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufic_ a.30.4.1 (C:) Dimerisation domain of CENP-B {Human (Homo sapiens)}
shmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrk

SCOP Domain Coordinates for d1ufic_:

Click to download the PDB-style file with coordinates for d1ufic_.
(The format of our PDB-style files is described here.)

Timeline for d1ufic_: