Lineage for d1ufic1 (1ufi C:5-49)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709045Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2709139Superfamily a.30.4: Dimerisation domain of CENP-B [101160] (1 family) (S)
    automatically mapped to Pfam PF09026
  5. 2709140Family a.30.4.1: Dimerisation domain of CENP-B [101161] (1 protein)
  6. 2709141Protein Dimerisation domain of CENP-B [101162] (1 species)
  7. 2709142Species Human (Homo sapiens) [TaxId:9606] [101163] (1 PDB entry)
  8. 2709145Domain d1ufic1: 1ufi C:5-49 [99338]
    Other proteins in same PDB: d1ufia2, d1ufic2, d1ufid2

Details for d1ufic1

PDB Entry: 1ufi (more details), 1.65 Å

PDB Description: Crystal structure of the dimerization domain of human CENP-B
PDB Compounds: (C:) major centromere autoantigen b

SCOPe Domain Sequences for d1ufic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufic1 a.30.4.1 (C:5-49) Dimerisation domain of CENP-B {Human (Homo sapiens) [TaxId: 9606]}
pvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrk

SCOPe Domain Coordinates for d1ufic1:

Click to download the PDB-style file with coordinates for d1ufic1.
(The format of our PDB-style files is described here.)

Timeline for d1ufic1: