SCOPe 2.08: Domain d1ufic1: 1ufi C:5-49

Lineage for d1ufic1 (1ufi C:5-49)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.4: Dimerisation domain of CENP-B [101160] (1 family)
   automatically mapped to Pfam PF09026

5. Family a.30.4.1: Dimerisation domain of CENP-B [101161] (1 protein)

6. Protein Dimerisation domain of CENP-B [101162] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101163] (1 PDB entry)

8. Domain d1ufic1: 1ufi C:5-49 [99338]
   Other proteins in same PDB: d1ufia2, d1ufic2, d1ufid2

Details for d1ufic1

PDB Entry: 1ufi, 1.65 Å

PDB Description: Crystal structure of the dimerization domain of human CENP-B

PDB Compounds: (C:) major centromere autoantigen b

SCOPe Domain Sequences for d1ufic1:

Sequence; same for both SEQRES and ATOM records:

>d1ufic1 a.30.4.1 (C:5-49) Dimerisation domain of CENP-B {Human (Homo sapiens) [TaxId: 9606]}
pvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrk

Timeline for d1ufic1:

• d1ufic1 first appeared in SCOP 1.67, called d1ufic_
  
• d1ufic1 appears in SCOPe 2.07