Lineage for d1ufib_ (1ufi B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732492Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1732563Superfamily a.30.4: Dimerisation domain of CENP-B [101160] (1 family) (S)
    automatically mapped to Pfam PF09026
  5. 1732564Family a.30.4.1: Dimerisation domain of CENP-B [101161] (1 protein)
  6. 1732565Protein Dimerisation domain of CENP-B [101162] (1 species)
  7. 1732566Species Human (Homo sapiens) [TaxId:9606] [101163] (1 PDB entry)
  8. 1732568Domain d1ufib_: 1ufi B: [99337]

Details for d1ufib_

PDB Entry: 1ufi (more details), 1.65 Å

PDB Description: Crystal structure of the dimerization domain of human CENP-B
PDB Compounds: (B:) major centromere autoantigen b

SCOPe Domain Sequences for d1ufib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufib_ a.30.4.1 (B:) Dimerisation domain of CENP-B {Human (Homo sapiens) [TaxId: 9606]}
pvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrkn

SCOPe Domain Coordinates for d1ufib_:

Click to download the PDB-style file with coordinates for d1ufib_.
(The format of our PDB-style files is described here.)

Timeline for d1ufib_: