Class a: All alpha proteins [46456] (286 folds) |
Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
Superfamily a.30.4: Dimerisation domain of CENP-B [101160] (1 family) automatically mapped to Pfam PF09026 |
Family a.30.4.1: Dimerisation domain of CENP-B [101161] (1 protein) |
Protein Dimerisation domain of CENP-B [101162] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101163] (1 PDB entry) |
Domain d1ufib_: 1ufi B: [99337] |
PDB Entry: 1ufi (more details), 1.65 Å
SCOPe Domain Sequences for d1ufib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ufib_ a.30.4.1 (B:) Dimerisation domain of CENP-B {Human (Homo sapiens) [TaxId: 9606]} pvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrkn
Timeline for d1ufib_: