SCOPe 2.06: Domain d1uffa1: 1uff A:8-88

Lineage for d1uffa1 (1uff A:8-88)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Intersectin 2 (KIAA1256) [101669] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101670] (5 PDB entries)
   Uniprot Q9NZM3 761-841, 897-957, 982-1037, 1055-1121, 1102-1186

8. Domain d1uffa1: 1uff A:8-88 [99335]
   Other proteins in same PDB: d1uffa2, d1uffa3
   structural genomics; first SH3 domain

Details for d1uffa1

PDB Entry: 1uff

PDB Description: solution structure of the first sh3 domain of human intersectin2 (kiaa1256)

PDB Compounds: (A:) Intersectin 2

SCOPe Domain Sequences for d1uffa1:

Sequence; same for both SEQRES and ATOM records:

>d1uffa1 b.34.2.1 (A:8-88) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]}
yralypfearnhdemsfnsgdiiqvdektvgepgwlygsfqgnfgwfpcnyvekmpssen
ekavspkkallpptvslsats

Timeline for d1uffa1:

• d1uffa1 first appeared in SCOP 1.67, called d1uffa_
  
• d1uffa1 was called d1uffa_ in SCOPe 2.05
  
• d1uffa1 appears in SCOPe 2.07
  
• d1uffa1 appears in the current release, SCOPe 2.08