Lineage for d1uffa_ (1uff A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 372467Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 372468Family b.34.2.1: SH3-domain [50045] (33 proteins)
  6. 372645Protein Intersectin 2 (KIAA1256) [101669] (1 species)
  7. 372646Species Human (Homo sapiens) [TaxId:9606] [101670] (3 PDB entries)
  8. 372647Domain d1uffa_: 1uff A: [99335]
    structural genomics; first SH3 domain

Details for d1uffa_

PDB Entry: 1uff (more details)

PDB Description: solution structure of the first sh3 domain of human intersectin2 (kiaa1256)

SCOP Domain Sequences for d1uffa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens)}
gssgssgyralypfearnhdemsfnsgdiiqvdektvgepgwlygsfqgnfgwfpcnyve
kmpssenekavspkkallpptvslsatsgpssg

SCOP Domain Coordinates for d1uffa_:

Click to download the PDB-style file with coordinates for d1uffa_.
(The format of our PDB-style files is described here.)

Timeline for d1uffa_: