Lineage for d1ufbd_ (1ufb D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535478Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 535832Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (4 families) (S)
  5. 535853Family a.24.16.3: HEPN domain [89022] (2 proteins)
  6. 535857Protein Hypothetical protein TT1696 [101123] (1 species)
  7. 535858Species Thermus thermophilus [TaxId:274] [101124] (1 PDB entry)
  8. 535862Domain d1ufbd_: 1ufb D: [99334]
    structural genomics; dimeric structure is more similar to that of HI0074 (1jog) than more closely related TM0613 (1ou3)

Details for d1ufbd_

PDB Entry: 1ufb (more details), 1.9 Å

PDB Description: Crystal structure of TT1696 from Thermus thermophilus HB8

SCOP Domain Sequences for d1ufbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufbd_ a.24.16.3 (D:) Hypothetical protein TT1696 {Thermus thermophilus}
mnrardwleqarhnlrhaqgslglgdyawacfaaqqaaeaalkglhlargqvawghsild
lladlpedvdvpedlveaakvldkyyiptrypdahpagpaarhytrleaeealdlaqkil
afveekl

SCOP Domain Coordinates for d1ufbd_:

Click to download the PDB-style file with coordinates for d1ufbd_.
(The format of our PDB-style files is described here.)

Timeline for d1ufbd_: