Lineage for d1ufbb_ (1ufb B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700508Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) (S)
  5. 2700563Family a.24.16.3: HEPN domain [89022] (2 proteins)
    automatically mapped to Pfam PF05168
  6. 2700567Protein Hypothetical protein TT1696 [101123] (1 species)
  7. 2700568Species Thermus thermophilus [TaxId:274] [101124] (1 PDB entry)
  8. 2700570Domain d1ufbb_: 1ufb B: [99332]
    structural genomics; dimeric structure is more similar to that of HI0074 (1jog) than more closely related TM0613 (1ou3)

Details for d1ufbb_

PDB Entry: 1ufb (more details), 1.9 Å

PDB Description: Crystal structure of TT1696 from Thermus thermophilus HB8
PDB Compounds: (B:) TT1696 protein

SCOPe Domain Sequences for d1ufbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufbb_ a.24.16.3 (B:) Hypothetical protein TT1696 {Thermus thermophilus [TaxId: 274]}
mnrardwleqarhnlrhaqgslglgdyawacfaaqqaaeaalkglhlargqvawghsild
lladlpedvdvpedlveaakvldkyyiptrypdahpagpaarhytrleaeealdlaqkil
afveekl

SCOPe Domain Coordinates for d1ufbb_:

Click to download the PDB-style file with coordinates for d1ufbb_.
(The format of our PDB-style files is described here.)

Timeline for d1ufbb_: