SCOPe 2.06: Domain d1ufba_: 1ufb A:

Lineage for d1ufba_ (1ufb A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families)

5. Family a.24.16.3: HEPN domain [89022] (2 proteins)
   automatically mapped to Pfam PF05168

6. Protein Hypothetical protein TT1696 [101123] (1 species)

7. Species Thermus thermophilus [TaxId:274] [101124] (1 PDB entry)

8. Domain d1ufba_: 1ufb A: [99331]
   structural genomics; dimeric structure is more similar to that of HI0074 (1jog) than more closely related TM0613 (1ou3)

Details for d1ufba_

PDB Entry: 1ufb, 1.9 Å

PDB Description: Crystal structure of TT1696 from Thermus thermophilus HB8

PDB Compounds: (A:) TT1696 protein

SCOPe Domain Sequences for d1ufba_:

Sequence; same for both SEQRES and ATOM records:

>d1ufba_ a.24.16.3 (A:) Hypothetical protein TT1696 {Thermus thermophilus [TaxId: 274]}
mnrardwleqarhnlrhaqgslglgdyawacfaaqqaaeaalkglhlargqvawghsild
lladlpedvdvpedlveaakvldkyyiptrypdahpagpaarhytrleaeealdlaqkil
afveekl

Timeline for d1ufba_:

• d1ufba_ first appeared in SCOP 1.67
  
• d1ufba_ appears in SCOPe 2.05
  
• d1ufba_ appears in SCOPe 2.07
  
• d1ufba_ appears in the current release, SCOPe 2.08