Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) |
Family a.24.16.3: HEPN domain [89022] (2 proteins) automatically mapped to Pfam PF05168 |
Protein Hypothetical protein TT1696 [101123] (1 species) |
Species Thermus thermophilus [TaxId:274] [101124] (1 PDB entry) |
Domain d1ufba_: 1ufb A: [99331] structural genomics; dimeric structure is more similar to that of HI0074 (1jog) than more closely related TM0613 (1ou3) |
PDB Entry: 1ufb (more details), 1.9 Å
SCOPe Domain Sequences for d1ufba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ufba_ a.24.16.3 (A:) Hypothetical protein TT1696 {Thermus thermophilus [TaxId: 274]} mnrardwleqarhnlrhaqgslglgdyawacfaaqqaaeaalkglhlargqvawghsild lladlpedvdvpedlveaakvldkyyiptrypdahpagpaarhytrleaeealdlaqkil afveekl
Timeline for d1ufba_: