SCOP 1.69: Domain d1ufba_: 1ufb A:

Lineage for d1ufba_ (1ufb A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (23 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (4 families)

5. Family a.24.16.3: HEPN domain [89022] (2 proteins)

6. Protein Hypothetical protein TT1696 [101123] (1 species)

7. Species Thermus thermophilus [TaxId:274] [101124] (1 PDB entry)

8. Domain d1ufba_: 1ufb A: [99331]

Details for d1ufba_

PDB Entry: 1ufb, 1.9 Å

PDB Description: Crystal structure of TT1696 from Thermus thermophilus HB8

SCOP Domain Sequences for d1ufba_:

Sequence; same for both SEQRES and ATOM records:

>d1ufba_ a.24.16.3 (A:) Hypothetical protein TT1696 {Thermus thermophilus}
mnrardwleqarhnlrhaqgslglgdyawacfaaqqaaeaalkglhlargqvawghsild
lladlpedvdvpedlveaakvldkyyiptrypdahpagpaarhytrleaeealdlaqkil
afveekl

Timeline for d1ufba_:

• d1ufba_ first appeared in SCOP 1.67
  
• d1ufba_ appears in SCOP 1.71
  
• d1ufba_ appears in the current release, SCOPe 2.08