Lineage for d1ufaa2 (1ufa A:1-412)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577009Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 577051Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (5 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 577080Family c.6.2.4: Hypothetical protein TT1467, N-terminal domain [102189] (1 protein)
  6. 577081Protein Hypothetical protein TT1467, N-terminal domain [102190] (1 species)
  7. 577082Species Thermus thermophilus [TaxId:274] [102191] (1 PDB entry)
  8. 577083Domain d1ufaa2: 1ufa A:1-412 [99330]
    Other proteins in same PDB: d1ufaa1
    structural genomics

Details for d1ufaa2

PDB Entry: 1ufa (more details), 2.2 Å

PDB Description: crystal structure of tt1467 from thermus thermophilus hb8

SCOP Domain Sequences for d1ufaa2:

Sequence, based on SEQRES records: (download)

>d1ufaa2 c.6.2.4 (A:1-412) Hypothetical protein TT1467, N-terminal domain {Thermus thermophilus}
marfalvlhahlpyvrahgmwpfgeetlyeamaetylplirvlerlraegveapftlgit
pilaeqladarikegfwayakdrleraqgdyqryrgtaleasarhqvafweltldhfqrl
sgdlvaafrkaeeggqvelitsnathgyspllgydealwaqiktgvstyrrhfakdptgf
wlpemayrpkgpwkppvegppegvrpgvdellmragirytfvdahlvqggeplspygeaa
lgpvesqeatyhvhelesglrvlarnpettlqvwsadygypgeglyrefhrkdplsglhh
wrvthrkadlaekapydpeaafakteeharhfvgllerlagrhpegvilspydaelfghw
wyegvawleavlrllaqnpkvrpvtareavqgpavrtalpegswgrggdhrv

Sequence, based on observed residues (ATOM records): (download)

>d1ufaa2 c.6.2.4 (A:1-412) Hypothetical protein TT1467, N-terminal domain {Thermus thermophilus}
marfalvlhahlpyvrahgmwpfgeetlyeamaetylplirvlerlraegveapftlgit
pilaeqladarikegfwayakdrleraqgdyqryrgtaleasarhqvafweltldhfqrl
sgdlvaafrkaeeggqvelitsnathgyspllgydealwaqiktgvstyrrhfakdptgf
wlpemayrpkgpwkppvegppegvrpgvdellmragirytfvdahlvqggeplspvesqe
atyhvhelesglrvlarnpettlqvwsadygypgeglyrefhrkdplsglhhwrvthrka
dlaekapydpeaafakteeharhfvgllerlagrhpegvilspydaelfghwwyegvawl
eavlrllaqnpkvrpvtareavqgpavrtalpegswgrggdhrv

SCOP Domain Coordinates for d1ufaa2:

Click to download the PDB-style file with coordinates for d1ufaa2.
(The format of our PDB-style files is described here.)

Timeline for d1ufaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ufaa1