Lineage for d1uf9c_ (1uf9 C:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393333Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (16 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 393441Protein Dephospho-CoA kinase [75187] (3 species)
  7. 393460Species Thermus thermophilus [TaxId:274] [102344] (1 PDB entry)
    TT1252
  8. 393463Domain d1uf9c_: 1uf9 C: [99328]
    structural genomics
    complexed with atp, po4

Details for d1uf9c_

PDB Entry: 1uf9 (more details), 2.8 Å

PDB Description: Crystal structure of TT1252 from Thermus thermophilus

SCOP Domain Sequences for d1uf9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uf9c_ c.37.1.1 (C:) Dephospho-CoA kinase {Thermus thermophilus}
khpiiigitgnigsgkstvaallrswgypvldldalaararenkeeelkrlfpeavvggr
ldrralarlvfsdperlkaleavvhpevrrllmeelsrleaplvfleipllfekgwegrl
hgtllvaapleervrrvmarsglsreevlareraqmpeeekrkratwvlentgsledler
alkavlaeltg

SCOP Domain Coordinates for d1uf9c_:

Click to download the PDB-style file with coordinates for d1uf9c_.
(The format of our PDB-style files is described here.)

Timeline for d1uf9c_: