![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (16 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Dephospho-CoA kinase [75187] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102344] (1 PDB entry) TT1252 |
![]() | Domain d1uf9a_: 1uf9 A: [99326] |
PDB Entry: 1uf9 (more details), 2.8 Å
SCOP Domain Sequences for d1uf9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus} khpiiigitgnigsgkstvaallrswgypvldldalaararenkeeelkrlfpeavvggr ldrralarlvfsdperlkaleavvhpevrrllmeelsrleaplvfleipllfekgwegrl hgtllvaapleervrrvmarsglsreevlareraqmpeeekrkratwvlentgsledler alkavlaeltg
Timeline for d1uf9a_: