Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Dephospho-CoA kinase [75187] (4 species) |
Species Thermus thermophilus [TaxId:274] [102344] (1 PDB entry) TT1252 |
Domain d1uf9a_: 1uf9 A: [99326] structural genomics complexed with atp, po4 |
PDB Entry: 1uf9 (more details), 2.8 Å
SCOPe Domain Sequences for d1uf9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} khpiiigitgnigsgkstvaallrswgypvldldalaararenkeeelkrlfpeavvggr ldrralarlvfsdperlkaleavvhpevrrllmeelsrleaplvfleipllfekgwegrl hgtllvaapleervrrvmarsglsreevlareraqmpeeekrkratwvlentgsledler alkavlaeltg
Timeline for d1uf9a_: