Lineage for d1uf3h_ (1uf3 H:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420529Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 420530Superfamily d.159.1: Metallo-dependent phosphatases [56300] (6 families) (S)
  5. 420597Family d.159.1.6: Hypothetical protein TT1561 [103320] (1 protein)
    similar to purple acid and protein phosphatases
  6. 420598Protein Hypothetical protein TT1561 [103321] (1 species)
  7. 420599Species Thermus thermophilus [TaxId:274] [103322] (1 PDB entry)
  8. 420607Domain d1uf3h_: 1uf3 H: [99324]
    structural genomics
    complexed with ca

Details for d1uf3h_

PDB Entry: 1uf3 (more details), 2.1 Å

PDB Description: Crystal structure of TT1561 of thermus thermophilus HB8

SCOP Domain Sequences for d1uf3h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uf3h_ d.159.1.6 (H:) Hypothetical protein TT1561 {Thermus thermophilus}
mrrtvryilatsnpmgdlealekfvklapdtgadaialignlmpkaaksrdyaaffrils
eahlptayvpgpqdapiweylreaanvelvhpemrnvhetftfwrgpylvagvggeiade
gepeehealrypawvaeyrlkalwelkdypkiflfhtmpyhkglneqgshevahlikthn
pllvlvagkgqkhemlgaswvvvpgdlsegeyslldlrarkletgnvr

SCOP Domain Coordinates for d1uf3h_:

Click to download the PDB-style file with coordinates for d1uf3h_.
(The format of our PDB-style files is described here.)

Timeline for d1uf3h_: