Lineage for d1uf3b_ (1uf3 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998340Family d.159.1.6: TT1561-like [103320] (2 proteins)
    similar to purple acid and protein phosphatases
  6. 2998341Protein Hypothetical protein TT1561 [103321] (1 species)
  7. 2998342Species Thermus thermophilus [TaxId:274] [103322] (1 PDB entry)
  8. 2998344Domain d1uf3b_: 1uf3 B: [99318]
    structural genomics
    complexed with ca

Details for d1uf3b_

PDB Entry: 1uf3 (more details), 2.1 Å

PDB Description: Crystal structure of TT1561 of thermus thermophilus HB8
PDB Compounds: (B:) hypothetical protein TT1561

SCOPe Domain Sequences for d1uf3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uf3b_ d.159.1.6 (B:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]}
rtvryilatsnpmgdlealekfvklapdtgadaialignlmpkaaksrdyaaffrilsea
hlptayvpgpqdapiweylreaanvelvhpemrnvhetftfwrgpylvagvggeiadege
peehealrypawvaeyrlkalwelkdypkiflfhtmpyhkglneqgshevahlikthnpl
lvlvagkgqkhemlgaswvvvpgdlsegeyslldlrarkletgnvr

SCOPe Domain Coordinates for d1uf3b_:

Click to download the PDB-style file with coordinates for d1uf3b_.
(The format of our PDB-style files is described here.)

Timeline for d1uf3b_: