Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.6: TT1561-like [103320] (2 proteins) similar to purple acid and protein phosphatases |
Protein Hypothetical protein TT1561 [103321] (1 species) |
Species Thermus thermophilus [TaxId:274] [103322] (1 PDB entry) |
Domain d1uf3a_: 1uf3 A: [99317] structural genomics complexed with ca |
PDB Entry: 1uf3 (more details), 2.1 Å
SCOPe Domain Sequences for d1uf3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} mrrtvryilatsnpmgdlealekfvklapdtgadaialignlmpkaaksrdyaaffrils eahlptayvpgpqdapiweylreaanvelvhpemrnvhetftfwrgpylvagvggeiade gepeehealrypawvaeyrlkalwelkdypkiflfhtmpyhkglneqgshevahlikthn pllvlvagkgqkhemlgaswvvvpgdlsegeyslldlrarkletgnvr
Timeline for d1uf3a_: