Lineage for d1uf2s1 (1uf2 S:1-147,S:301-421)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725196Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)
    multihelical; three-helical bundle in the core is surrounded by non-conserved helices
  4. 2725197Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (3 families) (S)
    this domain is interrupted by a jelly-roll beta-sandwich domain
  5. 2725226Family a.115.1.3: Phytoreovirus capsid [101395] (1 protein)
  6. 2725227Protein RDV p8 [101396] (1 species)
  7. 2725228Species Rice dwarf virus [TaxId:10991] [101397] (1 PDB entry)
  8. 2725240Domain d1uf2s1: 1uf2 S:1-147,S:301-421 [99313]
    Other proteins in same PDB: d1uf2a_, d1uf2b_, d1uf2c2, d1uf2d2, d1uf2e2, d1uf2f2, d1uf2g2, d1uf2h2, d1uf2i2, d1uf2j2, d1uf2p2, d1uf2q2, d1uf2r2, d1uf2s2, d1uf2t2

Details for d1uf2s1

PDB Entry: 1uf2 (more details), 3.5 Å

PDB Description: the atomic structure of rice dwarf virus (rdv)
PDB Compounds: (S:) Outer capsid protein P8

SCOPe Domain Sequences for d1uf2s1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uf2s1 a.115.1.3 (S:1-147,S:301-421) RDV p8 {Rice dwarf virus [TaxId: 10991]}
msrqmwldtsalleaiseyvvrcngdtfsglttgdfnalsnmftqlsvssagyvsdprvp
lqtmsnmfvsfitstdrcgymlrktwfnsdtkptvsddfittyirprlqvpmsdtvrqln
nlslqpsakpklyerqnaimkgldipyXanrsqayytlnsitqtptsiddfdvsdflttf
lsqlracgqyeifsdamdqltnslitnymdppaipaglaftspwfrfserartilalqnv
dlnirklivrhlwvitsliavfgryyrpn

SCOPe Domain Coordinates for d1uf2s1:

Click to download the PDB-style file with coordinates for d1uf2s1.
(The format of our PDB-style files is described here.)

Timeline for d1uf2s1: