Class a: All alpha proteins [46456] (290 folds) |
Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily) multihelical; three-helical bundle in the core is surrounded by non-conserved helices |
Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (3 families) this domain is interrupted by a jelly-roll beta-sandwich domain |
Family a.115.1.3: Phytoreovirus capsid [101395] (1 protein) |
Protein RDV p8 [101396] (1 species) |
Species Rice dwarf virus [TaxId:10991] [101397] (1 PDB entry) |
Domain d1uf2s1: 1uf2 S:1-147,S:301-421 [99313] Other proteins in same PDB: d1uf2a_, d1uf2b_, d1uf2c2, d1uf2d2, d1uf2e2, d1uf2f2, d1uf2g2, d1uf2h2, d1uf2i2, d1uf2j2, d1uf2p2, d1uf2q2, d1uf2r2, d1uf2s2, d1uf2t2 |
PDB Entry: 1uf2 (more details), 3.5 Å
SCOPe Domain Sequences for d1uf2s1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uf2s1 a.115.1.3 (S:1-147,S:301-421) RDV p8 {Rice dwarf virus [TaxId: 10991]} msrqmwldtsalleaiseyvvrcngdtfsglttgdfnalsnmftqlsvssagyvsdprvp lqtmsnmfvsfitstdrcgymlrktwfnsdtkptvsddfittyirprlqvpmsdtvrqln nlslqpsakpklyerqnaimkgldipyXanrsqayytlnsitqtptsiddfdvsdflttf lsqlracgqyeifsdamdqltnslitnymdppaipaglaftspwfrfserartilalqnv dlnirklivrhlwvitsliavfgryyrpn
Timeline for d1uf2s1:
View in 3D Domains from other chains: (mouse over for more information) d1uf2a_, d1uf2b_, d1uf2c1, d1uf2c2, d1uf2d1, d1uf2d2, d1uf2e1, d1uf2e2, d1uf2f1, d1uf2f2, d1uf2g1, d1uf2g2, d1uf2h1, d1uf2h2, d1uf2i1, d1uf2i2, d1uf2j1, d1uf2j2, d1uf2p1, d1uf2p2, d1uf2q1, d1uf2q2, d1uf2r1, d1uf2r2, d1uf2t1, d1uf2t2 |