SCOP 1.67: Domain d1uf2r2: 1uf2 R:148-300

Lineage for d1uf2r2 (1uf2 R:148-300)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (3 families)
   forms homotrimers

5. Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins)
   this domain is inserted into a multihelical domain

6. Protein RDV p8, central (top) domain [100924] (2 species)

7. Species Rice dwarf virus [TaxId:10991] [101592] (1 PDB entry)

8. Domain d1uf2r2: 1uf2 R:148-300 [99312]
   Other proteins in same PDB: d1uf2a_, d1uf2b_, d1uf2c1, d1uf2d1, d1uf2e1, d1uf2f1, d1uf2g1, d1uf2h1, d1uf2i1, d1uf2j1, d1uf2p1, d1uf2q1, d1uf2r1, d1uf2s1, d1uf2t1

Details for d1uf2r2

PDB Entry: 1uf2, 3.5 Å

PDB Description: the atomic structure of rice dwarf virus (rdv)

SCOP Domain Sequences for d1uf2r2:

Sequence; same for both SEQRES and ATOM records:

>d1uf2r2 b.19.1.1 (R:148-300) RDV p8, central (top) domain {Rice dwarf virus}
sepiepcklfrsvagqtgnipmmgilatppaaqqqpffvaerrrilfgirsnaaipagay
qfvvpawasvlsvtgayvyftnsffgtiiagvtatataadaattftvptdannlpvqtds
rlsfslgggninlelgvaktgfcvaiegeftil

Timeline for d1uf2r2:

• d1uf2r2 is new in SCOP 1.67
  
• d1uf2r2 appears in SCOP 1.69
  
• d1uf2r2 appears in the current release, SCOPe 2.08