Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins) this domain is inserted into a multihelical domain |
Protein RDV p8, central (top) domain [100924] (2 species) |
Species Rice dwarf virus [TaxId:10991] [101592] (1 PDB entry) |
Domain d1uf2p2: 1uf2 P:148-300 [99308] Other proteins in same PDB: d1uf2a_, d1uf2b_, d1uf2c1, d1uf2d1, d1uf2e1, d1uf2f1, d1uf2g1, d1uf2h1, d1uf2i1, d1uf2j1, d1uf2p1, d1uf2q1, d1uf2r1, d1uf2s1, d1uf2t1 |
PDB Entry: 1uf2 (more details), 3.5 Å
SCOPe Domain Sequences for d1uf2p2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uf2p2 b.19.1.1 (P:148-300) RDV p8, central (top) domain {Rice dwarf virus [TaxId: 10991]} sepiepcklfrsvagqtgnipmmgilatppaaqqqpffvaerrrilfgirsnaaipagay qfvvpawasvlsvtgayvyftnsffgtiiagvtatataadaattftvptdannlpvqtds rlsfslgggninlelgvaktgfcvaiegeftil
Timeline for d1uf2p2:
View in 3D Domains from other chains: (mouse over for more information) d1uf2a_, d1uf2b_, d1uf2c1, d1uf2c2, d1uf2d1, d1uf2d2, d1uf2e1, d1uf2e2, d1uf2f1, d1uf2f2, d1uf2g1, d1uf2g2, d1uf2h1, d1uf2h2, d1uf2i1, d1uf2i2, d1uf2j1, d1uf2j2, d1uf2q1, d1uf2q2, d1uf2r1, d1uf2r2, d1uf2s1, d1uf2s2, d1uf2t1, d1uf2t2 |