SCOP 1.67: Domain d1uf2h1: 1uf2 H:1-147,H:301-421

Lineage for d1uf2h1 (1uf2 H:1-147,H:301-421)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)
   multihelical; three-helical bundle in the core is surrounded by non-conserved helices

4. Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (3 families)
   this domain is interrupted by a jelly-roll beta-sandwich domain

5. Family a.115.1.3: Phytoreovirus capsid [101395] (1 protein)

6. Protein RDV p8 [101396] (1 species)

7. Species Rice dwarf virus [TaxId:10991] [101397] (1 PDB entry)

8. Domain d1uf2h1: 1uf2 H:1-147,H:301-421 [99301]
   Other proteins in same PDB: d1uf2a_, d1uf2b_, d1uf2c2, d1uf2d2, d1uf2e2, d1uf2f2, d1uf2g2, d1uf2h2, d1uf2i2, d1uf2j2, d1uf2p2, d1uf2q2, d1uf2r2, d1uf2s2, d1uf2t2

Details for d1uf2h1

PDB Entry: 1uf2, 3.5 Å

PDB Description: the atomic structure of rice dwarf virus (rdv)

SCOP Domain Sequences for d1uf2h1:

Sequence; same for both SEQRES and ATOM records:

>d1uf2h1 a.115.1.3 (H:1-147,H:301-421) RDV p8 {Rice dwarf virus}
msrqmwldtsalleaiseyvvrcngdtfsglttgdfnalsnmftqlsvssagyvsdprvp
lqtmsnmfvsfitstdrcgymlrktwfnsdtkptvsddfittyirprlqvpmsdtvrqln
nlslqpsakpklyerqnaimkgldipyXanrsqayytlnsitqtptsiddfdvsdflttf
lsqlracgqyeifsdamdqltnslitnymdppaipaglaftspwfrfserartilalqnv
dlnirklivrhlwvitsliavfgryyrpn

Timeline for d1uf2h1:

• d1uf2h1 is new in SCOP 1.67
  
• d1uf2h1 appears in SCOP 1.69
  
• d1uf2h1 appears in the current release, SCOPe 2.08