Lineage for d1uf2a_ (1uf2 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019944Fold e.28: Reovirus inner layer core protein p3 [56830] (1 superfamily)
    large protein without apparent domain division; has a number of all-alpha regions and one all beta domain near the C-end
  4. 3019945Superfamily e.28.1: Reovirus inner layer core protein p3 [56831] (2 families) (S)
  5. 3019951Family e.28.1.2: Phytoreovirus core [103413] (1 protein)
    automatically mapped to Pfam PF09231
  6. 3019952Protein RDV p3 [103414] (1 species)
  7. 3019953Species Rice dwarf virus [TaxId:10991] [103415] (1 PDB entry)
  8. 3019954Domain d1uf2a_: 1uf2 A: [99289]
    Other proteins in same PDB: d1uf2c1, d1uf2c2, d1uf2d1, d1uf2d2, d1uf2e1, d1uf2e2, d1uf2f1, d1uf2f2, d1uf2g1, d1uf2g2, d1uf2h1, d1uf2h2, d1uf2i1, d1uf2i2, d1uf2j1, d1uf2j2, d1uf2p1, d1uf2p2, d1uf2q1, d1uf2q2, d1uf2r1, d1uf2r2, d1uf2s1, d1uf2s2, d1uf2t1, d1uf2t2

Details for d1uf2a_

PDB Entry: 1uf2 (more details), 3.5 Å

PDB Description: the atomic structure of rice dwarf virus (rdv)
PDB Compounds: (A:) Core protein P3

SCOPe Domain Sequences for d1uf2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uf2a_ e.28.1.2 (A:) RDV p3 {Rice dwarf virus [TaxId: 10991]}
qsvvsrtpiplskiglqdvkklfdinvikcgsslrivdepqvtfivsyakdiydkfmcie
hdsayepsltmhrvrviysmlndycakmisevpyessfvgelpvksvtlnklgdrnmdal
aehllfehdvvnaqrenrifyqrksapavpvifgddlepavreranlyhrysvpyhqiel
alhalandllsiqychptvvynylssrapnflrlddqvslkltsagigtlmprpvvqlld
ydlvymsplalnnlasrllrkislhlvmqmvtavqqdlgevvsvssnvtnpasaclvrmn
vqgvqtlavfiaqsmlnpnisygmisgltldcfsnfiygaclmlfqalippsaltarqrl
dinnrfayflikchatqattarlvanqviypvdaidqwqsngrdvlvaiynnllpgelvl
tnliqtyfrgntaqqaaeilipadqtsyganetralsapylfgapinmlapdarlstykr
dlalpdrspilittvegqnsisienlrhktgliramylngfvtqppawirnansntalls
rfldatpnllgiyeailantyanavnvycdsvyradipiewklhqsvdpqdllfgvfgiv
pqyqilneavpdffaggedililqliravydtlsnklgrnpadifhleevfkvieeivsv
lvqqkidvrkyftesmrsgsfskprwdnflrrpvaqrlpnlysvimtqadhvynymtqlt
hiipitdcfyivknsgfvdrgstgpviasssvyenvlkvvhtiadfdaanalrlqrrrvd
ntsytdslsdmfnglrsisssefvrsvngrsvftegridaikvnmrakfdlqfiteeggy
skppnvkklmfsdflsfldshksdyrpplltvpitiglnnlgetnsntlrmrseaideyf
ssyvgaqilvpinvvdtrvytefselrnfftgdvvirddpfdvwdgvkatyipigvhgvr
ldpngdq

SCOPe Domain Coordinates for d1uf2a_:

Click to download the PDB-style file with coordinates for d1uf2a_.
(The format of our PDB-style files is described here.)

Timeline for d1uf2a_: