SCOPe 2.05: Domain d1uf1a_: 1uf1 A:

Lineage for d1uf1a_ (1uf1 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein KIAA1526 protein [101721] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101722] (3 PDB entries)

8. Domain d1uf1a_: 1uf1 A: [99288]
   structural genomics; second PDZ domain

Details for d1uf1a_

PDB Entry: 1uf1

PDB Description: solution structure of the second pdz domain of human kiaa1526 protein

PDB Compounds: (A:) KIAA1526 Protein

SCOPe Domain Sequences for d1uf1a_:

Sequence; same for both SEQRES and ATOM records:

>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]}
gssgssgdrrstlhllqggdekkvnlvlgdgrslgltirggaeyglgiyitgvdpgseae
gsglkvgdqilevngrsflnilhdeavrllkssrhliltvkdvgrlpharttvdetkwia
sssgpssg

Timeline for d1uf1a_:

• d1uf1a_ first appeared in SCOP 1.67
  
• d1uf1a_ appears in SCOPe 2.04
  
• d1uf1a_ is called d1uf1a1 in SCOPe 2.06
  
• d1uf1a_ appears in the current release, SCOPe 2.08, called d1uf1a1