SCOPe 2.05: Domain d1uf0a_: 1uf0 A:

Lineage for d1uf0a_ (1uf0 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.11: Doublecortin (DC) [89837] (1 family)
   possibly related to the ubiquitin-like superfamily

5. Family d.15.11.1: Doublecortin (DC) [89838] (3 proteins)

6. Protein Doublecortin-like kinase Dclk [89839] (1 species)
   KIAA0369; duplication: contains tandem repeat of two DC domains

7. Species Human (Homo sapiens) [TaxId:9606] [89840] (3 PDB entries)

8. Domain d1uf0a_: 1uf0 A: [99287]
   structural genomics; N-terminal DC domain

Details for d1uf0a_

PDB Entry: 1uf0

PDB Description: solution structure of the n-terminal dcx domain of human doublecortin- like kinase

PDB Compounds: (A:) Serine/threonine-protein kinase DCAMKL1

SCOPe Domain Sequences for d1uf0a_:

Sequence; same for both SEQRES and ATOM records:

>d1uf0a_ d.15.11.1 (A:) Doublecortin-like kinase Dclk {Human (Homo sapiens) [TaxId: 9606]}
gssgssgkkakkvrfyrngdryfkgivyaispdrfrsfealladltrtlsdnvnlpqgvr
tiytidglkkissldqlvegesyvcgsiepfkkleytknvnpnwsvnvktsgpssg

Timeline for d1uf0a_:

• d1uf0a_ first appeared in SCOP 1.67
  
• d1uf0a_ appears in SCOPe 2.04
  
• d1uf0a_ is called d1uf0a1 in SCOPe 2.06
  
• d1uf0a_ appears in the current release, SCOPe 2.08, called d1uf0a1