SCOPe 2.06: Domain d1ueza1: 1uez A:8-95

Lineage for d1ueza1 (1uez A:8-95)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein KIAA1526 protein [101721] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101722] (3 PDB entries)

8. Domain d1ueza1: 1uez A:8-95 [99286]
   Other proteins in same PDB: d1ueza2, d1ueza3
   structural genomics; first PDZ domain

Details for d1ueza1

PDB Entry: 1uez

PDB Description: solution structure of the first pdz domain of human kiaa1526 protein

PDB Compounds: (A:) KIAA1526 Protein

SCOPe Domain Sequences for d1ueza1:

Sequence; same for both SEQRES and ATOM records:

>d1ueza1 b.36.1.1 (A:8-95) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]}
evrlvslrrakaheglgfsirggsehgvgiyvslvepgslaekeglrvgdqilrvndksl
arvthaeavkalkgskklvlsvysagri

Timeline for d1ueza1:

• d1ueza1 first appeared in SCOP 1.67, called d1ueza_
  
• d1ueza1 was called d1ueza_ in SCOPe 2.05
  
• d1ueza1 appears in SCOPe 2.07
  
• d1ueza1 appears in the current release, SCOPe 2.08