SCOPe 2.06: Domain d1ueya1: 1uey A:8-121

Lineage for d1ueya1 (1uey A:8-121)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein KIAA0343 protein [101531] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101532] (2 PDB entries)

8. Domain d1ueya1: 1uey A:8-121 [99285]
   Other proteins in same PDB: d1ueya2, d1ueya3
   structural genomics; first Fn3 module

Details for d1ueya1

PDB Entry: 1uey

PDB Description: solution structure of the first fibronectin type iii domain of human kiaa0343 protein

PDB Compounds: (A:) KIAA0343 protein

SCOPe Domain Sequences for d1ueya1:

Sequence; same for both SEQRES and ATOM records:

>d1ueya1 b.1.2.1 (A:8-121) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}
ptpapvydvpnppfdleltdqldksvqlswtpgddnnspitkfiieyedamhkpglwhhq
tevsgtqttaqlnlspyvnysfrvmavnsigkslpseaseqyltkasepdknpt

Timeline for d1ueya1:

• d1ueya1 first appeared in SCOP 1.67, called d1ueya_
  
• d1ueya1 was called d1ueya_ in SCOPe 2.05
  
• d1ueya1 appears in SCOPe 2.07
  
• d1ueya1 appears in the current release, SCOPe 2.08