SCOPe 2.05: Domain d1uexa_: 1uex A:

Lineage for d1uexa_ (1uex A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin alpha chain [88861] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Puff adder (Bitis arietans), bitiscetin [TaxId:8692] [88866] (2 PDB entries)

8. Domain d1uexa_: 1uex A: [99282]
   Other proteins in same PDB: d1uexb_, d1uexc_
   complexed with the von Willebrand factor a1 domain

Details for d1uexa_

PDB Entry: 1uex, 2.85 Å

PDB Description: Crystal structure of von Willebrand Factor A1 domain complexed with snake venom bitiscetin

PDB Compounds: (A:) bitiscetin alpha chain

SCOPe Domain Sequences for d1uexa_:

Sequence; same for both SEQRES and ATOM records:

>d1uexa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]}
gclpdwssykghcykvfkkvgtwedaekfcvensghlasidskeeadfvtklasqtltkf
vydawiglrdesktqqcspqwtdgssvvyenvdeptkcfgldvhteyrtwtdlpcgeknp
ficks

Timeline for d1uexa_:

• d1uexa_ first appeared in SCOP 1.67
  
• d1uexa_ appears in SCOPe 2.04
  
• d1uexa_ appears in SCOPe 2.06
  
• d1uexa_ appears in the current release, SCOPe 2.08