Lineage for d1ueua2 (1ueu A:2-142)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616179Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 616180Superfamily d.218.1: Nucleotidyltransferase [81301] (9 families) (S)
  5. 616359Family d.218.1.7: Archaeal tRNA CCA-adding enzyme catalytic domain [102940] (1 protein)
    similar overall structure to poly(A) polymerase, PAP
  6. 616360Protein tRNA nucleotidyltransferase, N-terminal domain [102941] (1 species)
  7. 616361Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102942] (10 PDB entries)
  8. 616366Domain d1ueua2: 1ueu A:2-142 [99276]
    Other proteins in same PDB: d1ueua1, d1ueua3
    complexed with act, ctp, mg

Details for d1ueua2

PDB Entry: 1ueu (more details), 2 Å

PDB Description: Divergent evolutions of trinucleotide polymerization revealed by an archaeal CCA-adding enzyme structure

SCOP Domain Sequences for d1ueua2:

Sequence, based on SEQRES records: (download)

>d1ueua2 d.218.1.7 (A:2-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeon Archaeoglobus fulgidus}
kveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgsleid
vfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkepk
niksavdrtpfhhkwlegrik

Sequence, based on observed residues (ATOM records): (download)

>d1ueua2 d.218.1.7 (A:2-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeon Archaeoglobus fulgidus}
kveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgsleid
vfllfpeefskeelrergleigkavldsyehpyvhgvvkgvevdvvpcyklkepkniksa
vdrtpfhhkwlegrik

SCOP Domain Coordinates for d1ueua2:

Click to download the PDB-style file with coordinates for d1ueua2.
(The format of our PDB-style files is described here.)

Timeline for d1ueua2: