SCOP 1.67: Domain d1ueua1: 1ueu A:143-257

Lineage for d1ueua1 (1ueu A:143-257)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (3 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein)

6. Protein tRNA nucleotidyltransferase, second domain [101275] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [101276] (7 PDB entries)

8. Domain d1ueua1: 1ueu A:143-257 [99275]
   Other proteins in same PDB: d1ueua2, d1ueua3
   complexed with act, ctp, mg

Details for d1ueua1

PDB Entry: 1ueu, 2 Å

PDB Description: Divergent evolutions of trinucleotide polymerization revealed by an archaeal CCA-adding enzyme structure

SCOP Domain Sequences for d1ueua1:

Sequence; same for both SEQRES and ATOM records:

>d1ueua1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeon Archaeoglobus fulgidus}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

Timeline for d1ueua1:

• d1ueua1 is new in SCOP 1.67
  
• d1ueua1 appears in SCOP 1.69
  
• d1ueua1 appears in the current release, SCOPe 2.08