![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
![]() | Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (3 families) ![]() this domain follows the catalytic nucleotidyltransferase domain |
![]() | Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein) |
![]() | Protein tRNA nucleotidyltransferase, second domain [101275] (1 species) |
![]() | Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [101276] (7 PDB entries) |
![]() | Domain d1ueta1: 1uet A:143-257 [99272] Other proteins in same PDB: d1ueta2, d1ueta3 complexed with act, ca, mg |
PDB Entry: 1uet (more details), 2 Å
SCOP Domain Sequences for d1ueta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ueta1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeon Archaeoglobus fulgidus} gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk
Timeline for d1ueta1: