SCOPe 2.06: Domain d1ueqa1: 1ueq A:8-118

Lineage for d1ueqa1 (1ueq A:8-118)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) [101719] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101720] (5 PDB entries)
   Uniprot Q86UL8 412-522, 600-682, 774-865, 913-1015, 1141-1230

8. Domain d1ueqa1: 1ueq A:8-118 [99271]
   Other proteins in same PDB: d1ueqa2, d1ueqa3
   structural genomics; first PDZ domain

Details for d1ueqa1

PDB Entry: 1ueq

PDB Description: Solution Structure of The First PDZ domain of Human Atrophin-1 Interacting Protein 1 (KIAA0705 protein)

PDB Compounds: (A:) membrane associated guanylate kinase inverted-2 (magi-2)

SCOPe Domain Sequences for d1ueqa1:

Sequence; same for both SEQRES and ATOM records:

>d1ueqa1 b.36.1.1 (A:8-118) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}
lftrdasqlkgtflsttlkksnmgfgftiiggdepdeflqvksvipdgpaaqdgkmetgd
vivyinevcvlghthadvvklfqsvpigqsvnlvlcrgyplpfdpedpans

Timeline for d1ueqa1:

• d1ueqa1 first appeared in SCOP 1.67, called d1ueqa_
  
• d1ueqa1 was called d1ueqa_ in SCOPe 2.05
  
• d1ueqa1 appears in the current release, SCOPe 2.07