Lineage for d1ueqa_ (1ueq A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373409Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 373410Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 373411Family b.36.1.1: PDZ domain [50157] (24 proteins)
  6. 373463Protein Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) [101719] (1 species)
  7. 373464Species Human (Homo sapiens) [TaxId:9606] [101720] (4 PDB entries)
  8. 373466Domain d1ueqa_: 1ueq A: [99271]
    structural genomics; first PDZ domain

Details for d1ueqa_

PDB Entry: 1ueq (more details)

PDB Description: Solution Structure of The First PDZ domain of Human Atrophin-1 Interacting Protein 1 (KIAA0705 protein)
PDB Compounds: (A:)

SCOP Domain Sequences for d1ueqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens)}
gssgssglftrdasqlkgtflsttlkksnmgfgftiiggdepdeflqvksvipdgpaaqd
gkmetgdvivyinevcvlghthadvvklfqsvpigqsvnlvlcrgyplpfdpedpansgp
ssg

SCOP Domain Coordinates for d1ueqa_:

Click to download the PDB-style file with coordinates for d1ueqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ueqa_: