Lineage for d1ueoa_ (1ueo A:)

  1. Root: SCOP 1.67
  2. 434008Class j: Peptides [58231] (111 folds)
  3. 435470Fold j.107: Penaeidin-3a [103726] (1 superfamily)
  4. 435471Superfamily j.107.1: Penaeidin-3a [103727] (1 family) (S)
  5. 435472Family j.107.1.1: Penaeidin-3a [103728] (1 protein)
  6. 435473Protein Penaeidin-3a [103729] (1 species)
    antimicrobial peptide; consists of N-terminal proline-rich tail and C-terminal cysteine-rich domain
  7. 435474Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [103730] (1 PDB entry)
  8. 435475Domain d1ueoa_: 1ueo A: [99269]

Details for d1ueoa_

PDB Entry: 1ueo (more details)

PDB Description: solution structure of the [t8a]-penaeidin-3

SCOP Domain Sequences for d1ueoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ueoa_ j.107.1.1 (A:) Penaeidin-3a {Pacific white shrimp (Litopenaeus vannamei)}
qvykggyarpiprpppfvrplpggpigpyngcpvscrgisfsqarsccsrlgrcchvgkg
ysg

SCOP Domain Coordinates for d1ueoa_:

Click to download the PDB-style file with coordinates for d1ueoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ueoa_: