Lineage for d1uena1 (1uen A:8-119)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2029371Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2029372Family b.1.2.1: Fibronectin type III [49266] (45 protein domains)
    Pfam PF00041
  6. 2029723Protein KIAA0343 protein [101531] (1 species)
  7. 2029724Species Human (Homo sapiens) [TaxId:9606] [101532] (2 PDB entries)
  8. 2029725Domain d1uena1: 1uen A:8-119 [99268]
    Other proteins in same PDB: d1uena2, d1uena3
    structural genomics; third Fn3 module

Details for d1uena1

PDB Entry: 1uen (more details)

PDB Description: Solution Structure of The Third Fibronectin III Domain of Human KIAA0343 Protein
PDB Compounds: (A:) KIAA0343 protein

SCOPe Domain Sequences for d1uena1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uena1 b.1.2.1 (A:8-119) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}
hsgedlpmvapgnvrvnvvnstlaevhwdpvplksirghlqgyriyywktqssskrnrrh
iekkiltfqgskthgmlpglepfshytlnvrvvngkgegpaspdrvfntpeg

SCOPe Domain Coordinates for d1uena1:

Click to download the PDB-style file with coordinates for d1uena1.
(The format of our PDB-style files is described here.)

Timeline for d1uena1: